PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 357563
Common NameARALYDRAFT_357563
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 107aa    MW: 13007.6 Da    PI: 9.9931
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
357563genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.72.7e-083372445
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     +T++E++l+ +  ++ G + W++Ia +++ gR ++++  +w 
           357563 33 MTEQEEDLIFRMYRLVGDR-WDLIAGRVP-GRQPEEIERYWI 72
                     7****************99.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007173.0E-62977IPR001005SANT/Myb domain
CDDcd001671.05E-53271No hitNo description
PfamPF002491.4E-73372IPR001005SANT/Myb domain
SuperFamilySSF466891.79E-73472IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.9E-103472IPR009057Homeodomain-like
PROSITE profilePS500906.3073471IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010091Biological Processtrichome branching
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 107 aa     Download sequence    Send to blast
MDNTDRRRRR KQHKTALHDS EEVSSIEWEF INMTEQEEDL IFRMYRLVGD RWDLIAGRVP  60
GRQPEEIERY WIMRNSEGFA EKRRQLHSSS HKHTKPHRPR FSIYPS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1612861e-156AY161286.1 Arabidopsis thaliana TRIPTYCHON mRNA, complete cds.
GenBankAY5195231e-156AY519523.1 Arabidopsis thaliana MYB transcription factor (At5g53200) mRNA, complete cds.
GenBankBT0246721e-156BT024672.1 Arabidopsis thaliana unknown protein (At5g53200) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002864228.14e-74hypothetical protein ARALYDRAFT_357563
SwissprotQ8GV051e-74TRY_ARATH; Transcription factor TRY
TrEMBLD7MSV54e-74D7MSV5_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_80013501e-73(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32328194
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53200.17e-76MYB_related family protein